VarMod
Variant Modeller

Modelling functional effects of non-synonymous variants


Submit     About     News     Help     Example     Contact     Disclaimer

Help

This page explains how to use VarMod with details on the submission options and how the results page should be interpreted. If you would like further details about the methods used see the About page. Multiple examples of output from VarMod can be viewed on the Examples page.
 

Submission Options

A number of inputs are required to run VarMod. They are:

  • protein amino acid sequence
  • single nucleotide variants that are to be analysed
  • UniProt identitifer for the protein (optional)

The protein sequence should be submitted in fasta format:
>Description
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIP YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

or just the amino acid code:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIP YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

The single nucleotdie variants being investigated must be submitted in the following format:
A50T
T234R
P99W
Using the single letter amino acid code to describe the variant. The first letter should be the wild type or standard amino acid at that position and the second one the amino acid it is changed to. The number between the two letters indicates the amino acid position at which the SNV occurs.

Additionally it is useful to submit the UniProt identifier of query sequence. This is necessary to perform the Protein-Protein interface analysis.

Interpreting VarMod Results

Summary of VarMod Predictions
VarMod runs multiple sequence and structural analyses, which are combined to make an overall prediction. Further details of how the data from the different processes are combined can be found in About. The results page initially provides the main prediction with indicators of the features relevant to the prediction full here

Results Summary Table

The results table displays the VarMod prediction for each of the varaiants along with a summary of the main features that VarMod has considered. There are columns are colour coded to indicate their relevance in range from red to blue with red indicating that the variant is likely to have an effect upon protein function and blue that the variant is likely not to affect protein function. Teh columns contain the following data:
  • VarMod Pred - The overall prediction made by VarMod
  • Interface - Is the variant within a protein-protein interface site
  • Binding site - Is the variant within a ligand binding site in the protein
  • Conservation - the level of conservation of the position
  • Size - Is there a difference in the size of the two amino acid side chains?
  • charge - Is there a change in the charge of the amino acids
  • functional group - do the variant result in amino acids that have different chemical functional grups?

Sequence Conservation View

The sequence conservation view displays the query protein sequence colour coded according the residue level conservation, which is calculated using Jensen Shannon divergence. A column below highlights each of the variants within the sequences. This enables the user to investigate the conservation in the region in which the variants are located.

Structural model view

The structural model view provides a JSmol viewer for the user to view a model of the protein with both functional residues (ligand binding and interface sites) and the variant residues mapped onto it. This enables the user to investigate the structural environment of each of the variants and its proximity to functional residues. By default the protein is coloured grey, interface residues blue, ligand binding residues purple and variant residues red. The control panel to the right enables the user to modify the display.

Control Panel

The control panel is split into multiple sections to enable the user to modify the display of the protein and investigate the variant and functional residues.

Basic Protein Controls These controls enable the user to modify the display of the whole protein. There are options to modify the colour of the protein and the display of the structure, which offers spacefill, wireframe or cartoon (default) options. Note that using these controls will modify ALL of the protein residues including the variants and functional residues. However, the user can then adjust these residues as they wish using the other sets of controls.

Variant Controls

The variant controls enable the user to modify the display of the variant residue positions. The top row of options modify ALL of the variant positions in the protein. This is followed by a row of controls for each of the individual variants. Options here allow the user to modify the colour and disaply of the variants with the same options as for the whole protein. . All variant positions are coloured red by default.

Functional Residue Controls

The functional residue controls enable the user to modify the display of the ligand binding site and interface residues. There are separate controls for each of these, which allow the user to modifiy the colour and display of these residues.

Submit     About     News     Help     Example     Contact     Disclaimer
Computational Biology Group, University of Kent, UK
Mark Wass